PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006635m
Common NameEUTSA_v10006635mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARF
Protein Properties Length: 1084aa    MW: 119803 Da    PI: 6.6526
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006635mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.3e-23126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++
  Thhalv10006635m 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFV--RD 215
                      99*****************************954.4444.48************************************************..45 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      ++ +l+++++r+
  Thhalv10006635m 216 EKSQLMLGIRRA 227
                      67778****997 PP

2Auxin_resp118.55.4e-39252334183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  Thhalv10006635m 252 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 334
                      799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.0E-42120241IPR015300DNA-binding pseudobarrel domain
CDDcd100176.76E-21125226No hitNo description
SMARTSM010191.0E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.534126228IPR003340B3 DNA binding domain
PfamPF023621.6E-21126227IPR003340B3 DNA binding domain
PfamPF065077.5E-34252334IPR010525Auxin response factor
PfamPF023095.3E-109531041IPR033389AUX/IAA domain
PROSITE profilePS5174525.6659551048IPR000270PB1 domain
SuperFamilySSF542771.77E-89691033No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1084 aa     Download sequence    Send to blast
MKAPSNGFHP NSTEGEKKAI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKLNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFVRDEKSQL MLGIRRANRQ TPTLSSSVIS  240
SDSMHIGILA AAAHANANSS PFTIFFNPRA SPSEFVVPLA KYNKALYAQV SLGMRFRMMF  300
ETEDCGVRRY MGTVTGISDL DPVRWKGSQW RNLQVGWDES TAGDRPSRVS IWEIEPVITP  360
FYICPPPFFR PKYPRQPGMP DDDLDIENAF KRAMPWMGEE FGMKDAQSSM FPGLSLVQWM  420
SMQQNNPLSA TTQLPSALSS YNLPNNFASN DPSKLLNFQS PNLSPANSQF NKPNMVNHIS  480
QQMQAQPAIV KSQQQQQQQQ QQLQQQVQMS HQQLQQHHQQ QQGIYNIGSV NNGVTVVSNQ  540
ASCQNQSTGF SQAQLQQQSM LSNGATMTQQ NIVSGGIKGS SQMTSLAQEL QFQQQLELHN  600
SSQLLRNQQE QSSMHTLQQT LSQNPQQLQM QQQSSKQSPS QQLQLQLLQK LQQQQQQQSI  660
PPVSSSIQPQ LSALQQAQSH QLQQLLSSQN QQPLAHGNNS FSASTFMQPP QIQVSHQQQG  720
QMNNKPLVTT GRSHSGHTDG EAPSCSTSPS ANNTGHDNVS PTNFLSRNLQ QGQGVSVSPS  780
DSVFERASNQ GQELYAKTES RVNQGMVNLK SAPEHFKFKG AVTDQLDVST AGATYCPDVV  840
GPAQQQQTFP LPSFGFDGDC QSQHPRNSLG FAGNLEAVTS DALYSQKDFH NLVPNYGNAP  900
RDIETELSSA AISSQSFGIP SIPFKSGGSN EIGGINDSGI MNGGGLWPNQ TQRMRTYTKV  960
QKRGSVGRSI DVTRYSGYEE LRHDLARMFG IEGQLEDPQT SDWKLVYTDH ENDILLVGDD  1020
PWEEFVNCVQ NIKILSSAEV QQMSLDGDLA AIPATNQACS ETDSGNAWKV HYEDTSAAAS  1080
FNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1721635547388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794840.0JN979484.1 Brassica rapa subsp. pekinensis auxin response factor 19-2 (ARF19-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416527.10.0hypothetical protein EUTSA_v10006635mg
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLV4KB060.0V4KB06_EUTSA; Auxin response factor
STRINGAT1G19220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19